- Recombinant Saccharomyces cerevisiae Increased recombination centers protein 18 (IRC18)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1214786
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 24,746 Da
- E Coli or Yeast
- 1-224
- Increased recombination centers protein 18 (IRC18)
- OSW6
Sequence
MKVQMIERIFLIQLCLLTVVLASSRAVVEFESTGTKLVNSLRVLAAYSQSSVCVDEKISGIERQIEEVKDMYGNHSFILKGLNGILNNKVNMLTREIQMETVGNNTFETETGKLTKGLNRAVNISPFKYIKKFKTVSTKKFESLLNKYDLVAKKGGELTEEQKKKKEVLSRISRVVAATTIEAGLAQGVVDLCITVTTSLCLVSASIGGVGFLIWLTIIYQALT